PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g045430.1
Common NameMTR_3g045430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 299aa    MW: 33430.5 Da    PI: 6.7829
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g045430.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T +E++l+v++++  G++ W+ Ia+ ++ gRt++++k+ w++
  Medtr3g045430.1  69 DKFTSQEEDLIVKLHAAIGSR-WSIIAQQLP-GRTDNDVKNNWNT 111
                      589******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.0151062IPR017877Myb-like domain
SMARTSM007172.31464IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-91874IPR009057Homeodomain-like
SuperFamilySSF466892.39E-1748121IPR009057Homeodomain-like
PROSITE profilePS5129417.11963117IPR017930Myb domain
SMARTSM007171.3E-967115IPR001005SANT/Myb domain
PfamPF002492.0E-1170111IPR001005SANT/Myb domain
CDDcd001671.38E-770113No hitNo description
Gene3DG3DSA:1.10.10.605.6E-1875117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVRSSSCEKN SVIKRSVWIA EEDAKTPSFV SEHGSVNLTS VPKKTGVKRY GKSCRLRWSN  60
SMSDPKHDDK FTSQEEDLIV KLHAAIGSRW SIIAQQLPGR TDNDVKNNWN TKLKKKLSQM  120
GIDPVTHKPF SKLIVDYGNI GGANCHINQD FRNQRLIRNT NDLSKQLPPK METVMNLCQF  180
QTSNNNNPTS MFVEAFLSSS SSTPLPTLSP CSSTSTQETN FSAPFSWNDF LLQDAFSQDA  240
PTNNLQEQQI LGGLLSKKEV VSHQVSSSSD ISFVETILDQ ENEMFLSFPE LLEEPSNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-191811710108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459501.10.0myb transcription factor
TrEMBLA0A072UV810.0A0A072UV81_MEDTR; Myb transcription factor
STRINGGLYMA06G20020.21e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-44MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]